Lineage for d1jpga2 (1jpg A:2-181)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1197982Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1197983Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 1197984Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1198031Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (27 species)
  7. 1198267Species Mouse (Mus musculus), H-2DB [TaxId:10090] [54482] (18 PDB entries)
  8. 1198275Domain d1jpga2: 1jpg A:2-181 [67020]
    Other proteins in same PDB: d1jpga1, d1jpgb_

Details for d1jpga2

PDB Entry: 1jpg (more details), 2.2 Å

PDB Description: crystal structure of the lcmv peptidic epitope np396 in complex with the murine class i mhc molecule h-2db
PDB Compounds: (A:) H-2 class I histocompatibility antigen, D-B alpha chain

SCOPe Domain Sequences for d1jpga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jpga2 d.19.1.1 (A:2-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2DB [TaxId: 10090]}
phsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeywe
retqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayegr
dyialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatllr

SCOPe Domain Coordinates for d1jpga2:

Click to download the PDB-style file with coordinates for d1jpga2.
(The format of our PDB-style files is described here.)

Timeline for d1jpga2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jpga1
View in 3D
Domains from other chains:
(mouse over for more information)
d1jpgb_