SCOP 1.69: Domain d1jpga2: 1jpg A:2-181

Lineage for d1jpga2 (1jpg A:2-181)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)

6. Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (21 species)

7. Species Mouse (Mus musculus), H-2DB [TaxId:10090] [54482] (18 PDB entries)

8. Domain d1jpga2: 1jpg A:2-181 [67020]
   Other proteins in same PDB: d1jpga1, d1jpgb_

Details for d1jpga2

PDB Entry: 1jpg, 2.2 Å

PDB Description: crystal structure of the lcmv peptidic epitope np396 in complex with the murine class i mhc molecule h-2db

SCOP Domain Sequences for d1jpga2:

Sequence; same for both SEQRES and ATOM records:

>d1jpga2 d.19.1.1 (A:2-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2DB}
phsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeywe
retqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayegr
dyialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatllr

Timeline for d1jpga2:

• d1jpga2 first appeared in SCOP 1.59
  
• d1jpga2 appears in SCOP 1.67
  
• d1jpga2 appears in SCOP 1.71
  
• d1jpga2 appears in the current release, SCOPe 2.08