SCOP 1.59: Domain d1jpga1: 1jpg A:182-276

Lineage for d1jpga1 (1jpg A:182-276)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Class I MHC, beta2-microglobulin and alpha-3 domain [48945] (20 species)

7. Species Mouse (Mus musculus), H-2DB [TaxId:10090] [48960] (7 PDB entries)

8. Domain d1jpga1: 1jpg A:182-276 [67019]
   Other proteins in same PDB: d1jpga2

Details for d1jpga1

PDB Entry: 1jpg, 2.2 Å

PDB Description: crystal structure of the lcmv peptidic epitope np396 in complex with the murine class i mhc molecule h-2db

SCOP Domain Sequences for d1jpga1:

Sequence; same for both SEQRES and ATOM records:

>d1jpga1 b.1.1.2 (A:182-276) Class I MHC, beta2-microglobulin and alpha-3 domain {Mouse (Mus musculus), H-2DB}
tdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgtf
qkwasvvvplgkeqnytcrvyheglpepltlrwep

Timeline for d1jpga1:

• d1jpga1 is new in SCOP 1.59
  
• d1jpga1 appears in SCOP 1.61
  
• d1jpga1 appears in the current release, SCOPe 2.08