Lineage for d1jpga1 (1jpg A:182-276)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2746844Protein Class I MHC, alpha-3 domain [88604] (4 species)
  7. 2747150Species Mouse (Mus musculus) [TaxId:10090] [88606] (111 PDB entries)
    Uniprot P01901 22-299
  8. 2747184Domain d1jpga1: 1jpg A:182-276 [67019]
    Other proteins in same PDB: d1jpga2, d1jpgb_

Details for d1jpga1

PDB Entry: 1jpg (more details), 2.2 Å

PDB Description: crystal structure of the lcmv peptidic epitope np396 in complex with the murine class i mhc molecule h-2db
PDB Compounds: (A:) H-2 class I histocompatibility antigen, D-B alpha chain

SCOPe Domain Sequences for d1jpga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jpga1 b.1.1.2 (A:182-276) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
tdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgtf
qkwasvvvplgkeqnytcrvyheglpepltlrwep

SCOPe Domain Coordinates for d1jpga1:

Click to download the PDB-style file with coordinates for d1jpga1.
(The format of our PDB-style files is described here.)

Timeline for d1jpga1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jpga2
View in 3D
Domains from other chains:
(mouse over for more information)
d1jpgb_