Lineage for d1jpfa1 (1jpf A:182-276)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1103262Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1105902Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1106699Protein Class I MHC, alpha-3 domain [88604] (4 species)
  7. 1106920Species Mouse (Mus musculus) [TaxId:10090] [88606] (89 PDB entries)
    Uniprot P01901 22-299
  8. 1106961Domain d1jpfa1: 1jpf A:182-276 [67016]
    Other proteins in same PDB: d1jpfa2, d1jpfb_

Details for d1jpfa1

PDB Entry: 1jpf (more details), 2.18 Å

PDB Description: crystal structure of the lcmv peptidic epitope gp276 in complex with the murine class i mhc molecule h-2db
PDB Compounds: (A:) H-2 class I histocompatibility antigen, D-B alpha chain

SCOPe Domain Sequences for d1jpfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jpfa1 b.1.1.2 (A:182-276) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
tdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgtf
qkwasvvvplgkeqnytcrvyheglpepltlrwep

SCOPe Domain Coordinates for d1jpfa1:

Click to download the PDB-style file with coordinates for d1jpfa1.
(The format of our PDB-style files is described here.)

Timeline for d1jpfa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jpfa2
View in 3D
Domains from other chains:
(mouse over for more information)
d1jpfb_