Lineage for d1jpdx2 (1jpd X:-2-113)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2947581Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2947582Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2947583Family d.54.1.1: Enolase N-terminal domain-like [54827] (15 proteins)
    C-terminal domain is beta/alpha-barrel
  6. 2947754Protein L-Ala-D/L-Glu epimerase [69711] (2 species)
  7. 2947768Species Escherichia coli [TaxId:562] [69712] (1 PDB entry)
  8. 2947769Domain d1jpdx2: 1jpd X:-2-113 [67015]
    Other proteins in same PDB: d1jpdx1

Details for d1jpdx2

PDB Entry: 1jpd (more details), 2.6 Å

PDB Description: L-Ala-D/L-Glu Epimerase
PDB Compounds: (X:) L-Ala-D/L-Glu Epimerase

SCOPe Domain Sequences for d1jpdx2:

Sequence, based on SEQRES records: (download)

>d1jpdx2 d.54.1.1 (X:-2-113) L-Ala-D/L-Glu epimerase {Escherichia coli [TaxId: 562]}
gshmrtvkvfeeawplhtpfviargsrsearvvvveleeegikgtgectpyprygesdas
vmaqimsvvpqlekgltreelqkilpagaarnaldcalwdlaarrqqqsladligi

Sequence, based on observed residues (ATOM records): (download)

>d1jpdx2 d.54.1.1 (X:-2-113) L-Ala-D/L-Glu epimerase {Escherichia coli [TaxId: 562]}
gshmrtvkvfeeawplhtpsrsearvvvveleeegikgtgectpyprygesdasvmaqim
svvpqlekgltreelqkilpagaarnaldcalwdlaarrqqqsladligi

SCOPe Domain Coordinates for d1jpdx2:

Click to download the PDB-style file with coordinates for d1jpdx2.
(The format of our PDB-style files is described here.)

Timeline for d1jpdx2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jpdx1