SCOP 1.75: Domain d1jpab_: 1jpa B:

Lineage for d1jpab_ (1jpa B:)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (63 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein ephb2 receptor tyrosine kinase [69827] (1 species)
   PTK group; Eph/Elk/Eck subfamily; membrane spanning protein tyrosine kinase

7. Species Mouse (Mus musculus) [TaxId:10090] [69828] (1 PDB entry)

8. Domain d1jpab_: 1jpa B: [67012]
   complexed with anp; mutant

Details for d1jpab_

PDB Entry: 1jpa, 1.91 Å

PDB Description: crystal structure of unphosphorylated ephb2 receptor tyrosine kinase and juxtamembrane region

PDB Compounds: (B:) neural kinase, Nuk=Eph/Elk/Eck family receptor-like tyrosine kinase

SCOP Domain Sequences for d1jpab_:

Sequence, based on SEQRES records:

>d1jpab_ d.144.1.7 (B:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]}
kifidpftfedpneavrefakeidiscvkieqvigagefgevcsghlklpgkreifvaik
tlksgytekqrrdflseasimgqfdhpnvihlegvvtkstpvmiitefmengsldsflrq
ndgqftviqlvgmlrgiaagmkyladmnyvhrdlaarnilvnsnlvckvsdfglsrfled
dtsdptytsalggkipirwtapeaiqyrkftsasdvwsygivmwevmsygerpywdmtnq
dvinaieqdyrlpppmdcpsalhqlmldcwqkdrnhrpkfgqivntldkmirnpnslk

Sequence, based on observed residues (ATOM records):

>d1jpab_ d.144.1.7 (B:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]}
kifidpftfedpneavrefakeidiscvkieqvigagefgevcsghlkreifvaiktlks
gytekqrrdflseasimgqfdhpnvihlegvvtkspvmiitefmengsldsflrqndgqf
tviqlvgmlrgiaagmkyladmnyvhrdlaarnilvnsnlvckvsdfpirwtapeaiqyr
kftsasdvwsygivmwevmsygerpywdmtndvinaieqdyrlpppmdcpsalhqlmldc
wqkdrnhrpkfgqivntldkmirnpnslk

Timeline for d1jpab_:

• d1jpab_ first appeared in SCOP 1.59
  
• d1jpab_ appears in SCOP 1.73
  
• d1jpab_ appears in SCOPe 2.01
  
• d1jpab_ appears in the current release, SCOPe 2.08