Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (60 proteins) members organized in the groups and subfamiles specified by the comments |
Protein ephb2 receptor tyrosine kinase [69827] (1 species) PTK group; Eph/Elk/Eck subfamily; membrane spanning protein tyrosine kinase |
Species Mouse (Mus musculus) [TaxId:10090] [69828] (1 PDB entry) |
Domain d1jpab_: 1jpa B: [67012] complexed with anp; mutant |
PDB Entry: 1jpa (more details), 1.91 Å
SCOP Domain Sequences for d1jpab_:
Sequence, based on SEQRES records: (download)
>d1jpab_ d.144.1.7 (B:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus)} kifidpftfedpneavrefakeidiscvkieqvigagefgevcsghlklpgkreifvaik tlksgytekqrrdflseasimgqfdhpnvihlegvvtkstpvmiitefmengsldsflrq ndgqftviqlvgmlrgiaagmkyladmnyvhrdlaarnilvnsnlvckvsdfglsrfled dtsdptytsalggkipirwtapeaiqyrkftsasdvwsygivmwevmsygerpywdmtnq dvinaieqdyrlpppmdcpsalhqlmldcwqkdrnhrpkfgqivntldkmirnpnslk
>d1jpab_ d.144.1.7 (B:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus)} kifidpftfedpneavrefakeidiscvkieqvigagefgevcsghlkreifvaiktlks gytekqrrdflseasimgqfdhpnvihlegvvtkspvmiitefmengsldsflrqndgqf tviqlvgmlrgiaagmkyladmnyvhrdlaarnilvnsnlvckvsdfpirwtapeaiqyr kftsasdvwsygivmwevmsygerpywdmtndvinaieqdyrlpppmdcpsalhqlmldc wqkdrnhrpkfgqivntldkmirnpnslk
Timeline for d1jpab_: