Lineage for d1jp6a_ (1jp6 A:)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 93449Fold a.1: Globin-like [46457] (2 superfamilies)
  4. 93450Superfamily a.1.1: Globin-like [46458] (3 families) (S)
  5. 93460Family a.1.1.2: Globins [46463] (18 proteins)
  6. 94046Protein Myoglobin [46469] (9 species)
  7. 94112Species Sperm whale (Physeter catodon) [TaxId:9755] [46470] (136 PDB entries)
  8. 94229Domain d1jp6a_: 1jp6 A: [67005]

Details for d1jp6a_

PDB Entry: 1jp6 (more details), 2.3 Å

PDB Description: Sperm Whale met-Myoglobin (room temperature; room pressure)

SCOP Domain Sequences for d1jp6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jp6a_ a.1.1.2 (A:) Myoglobin {Sperm whale (Physeter catodon)}
vlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkased
lkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp
gdfgadaqgamnkalelfrkdiaakykelgyq

SCOP Domain Coordinates for d1jp6a_:

Click to download the PDB-style file with coordinates for d1jp6a_.
(The format of our PDB-style files is described here.)

Timeline for d1jp6a_: