Lineage for d1jp5b2 (1jp5 B:128-247)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 362616Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 362617Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (24 proteins)
  6. 362751Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 363225Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88554] (29 PDB entries)
  8. 363246Domain d1jp5b2: 1jp5 B:128-247 [67004]
    Other proteins in same PDB: d1jp5a1, d1jp5b1
    part of scFv 1695; complexed with the epitope peptide from HIV-1 protease

Details for d1jp5b2

PDB Entry: 1jp5 (more details), 2.7 Å

PDB Description: Crystal structure of the single-chain Fv fragment 1696 in complex with the epitope peptide corresponding to N-terminus of HIV-1 protease

SCOP Domain Sequences for d1jp5b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jp5b2 b.1.1.1 (B:128-247) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 4}
evqlqqsgpelkkpgetvkisckatnyaftdysmhwvkqapggdlkyvgwintetdeptf
addfkgrfafsldtststaflqinnlknedtatyfcvrdrhdygeiftywgqgttvtvss

SCOP Domain Coordinates for d1jp5b2:

Click to download the PDB-style file with coordinates for d1jp5b2.
(The format of our PDB-style files is described here.)

Timeline for d1jp5b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jp5b1