Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species) VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species |
Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88554] (34 PDB entries) Uniprot P06327 20-117 # HV52_MOUSE (P06327) Ig heavy chain V region VH558 A1/A4 precursor; 57% sequence identity ! Uniprot P01631 # KV2G_MOUSE (P01631) Ig kappa chain V-II region 26-10 |
Domain d1jp5a2: 1jp5 A:128-247 [67002] Other proteins in same PDB: d1jp5a1, d1jp5b1 part of scFv 1695; complexed with the epitope peptide from HIV-1 protease |
PDB Entry: 1jp5 (more details), 2.7 Å
SCOPe Domain Sequences for d1jp5a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jp5a2 b.1.1.1 (A:128-247) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} evqlqqsgpelkkpgetvkisckatnyaftdysmhwvkqapggdlkyvgwintetdeptf addfkgrfafsldtststaflqinnlknedtatyfcvrdrhdygeiftywgqgttvtvss
Timeline for d1jp5a2: