SCOPe 2.06: Domain d1jowa2: 1jow A:149-254

Lineage for d1jowa2 (1jow A:149-254)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.74: Cyclin-like [47953] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.74.1: Cyclin-like [47954] (4 families)
   duplication: consists of two domains of this fold

5. Family a.74.1.1: Cyclin [47955] (9 proteins)

6. Protein Viral cyclin [47961] (3 species)

7. Species Herpesvirus saimiri [TaxId:10381] [47962] (7 PDB entries)

8. Domain d1jowa2: 1jow A:149-254 [66999]
   Other proteins in same PDB: d1jowb_

Details for d1jowa2

PDB Entry: 1jow, 3.1 Å

PDB Description: Crystal structure of a complex of human CDK6 and a viral cyclin

PDB Compounds: (A:) cyclin homolog

SCOPe Domain Sequences for d1jowa2:

Sequence; same for both SEQRES and ATOM records:

>d1jowa2 a.74.1.1 (A:149-254) Viral cyclin {Herpesvirus saimiri [TaxId: 10381]}
avlatdfliplcnalkipedlwpqlyeaasttickaliqpniallspglicaggllttie
tdntncrpwtcyledlssilnfstntvrtvkdqvseafslydleil

Timeline for d1jowa2:

• d1jowa2 first appeared in SCOP 1.59
  
• d1jowa2 appears in SCOPe 2.05
  
• d1jowa2 appears in SCOPe 2.07
  
• d1jowa2 appears in the current release, SCOPe 2.08