Lineage for d1jowa1 (1jow A:9-148)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 644042Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 644043Superfamily a.74.1: Cyclin-like [47954] (3 families) (S)
    duplication: consists of two domains of this fold
  5. 644044Family a.74.1.1: Cyclin [47955] (4 proteins)
  6. 644248Protein Viral cyclin [47961] (3 species)
  7. 644249Species Herpesvirus saimiri [TaxId:10381] [47962] (5 PDB entries)
  8. 644258Domain d1jowa1: 1jow A:9-148 [66998]
    Other proteins in same PDB: d1jowb_

Details for d1jowa1

PDB Entry: 1jow (more details), 3.1 Å

PDB Description: Crystal structure of a complex of human CDK6 and a viral cyclin
PDB Compounds: (A:) cyclin homolog

SCOP Domain Sequences for d1jowa1:

Sequence, based on SEQRES records: (download)

>d1jowa1 a.74.1.1 (A:9-148) Viral cyclin {Herpesvirus saimiri [TaxId: 10381]}
nrakidsttmkdprvlnnlklrelllpkftslweiqtevtvdnrtilltwmhllcesfel
dksvfplsvsildrylckkqgtkktlqkigaacvligskirtvkpmtvskltylscdcft
nlelinqekdilealkwdte

Sequence, based on observed residues (ATOM records): (download)

>d1jowa1 a.74.1.1 (A:9-148) Viral cyclin {Herpesvirus saimiri [TaxId: 10381]}
nrakidsttmkdprvlnnlklrelllpkftslweiqtevtvdnrtilltwmhllcesfel
dksvfplsvsildrylckkqgtkktlqkigaacvligskirtvkpmtvskltylsftnle
linqekdilealkwdte

SCOP Domain Coordinates for d1jowa1:

Click to download the PDB-style file with coordinates for d1jowa1.
(The format of our PDB-style files is described here.)

Timeline for d1jowa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jowa2
View in 3D
Domains from other chains:
(mouse over for more information)
d1jowb_