SCOP 1.65: Domain d1jowa1: 1jow A:9-148

Lineage for d1jowa1 (1jow A:9-148)

1. Root: SCOP 1.65

2. Class a: All alpha proteins [46456] (179 folds)

3. Fold a.74: Cyclin-like [47953] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.74.1: Cyclin-like [47954] (3 families)
   duplication: consists of two domains of this fold

5. Family a.74.1.1: Cyclin [47955] (4 proteins)

6. Protein Viral cyclin [47961] (3 species)

7. Species Herpes virus saimiri [47962] (2 PDB entries)

8. Domain d1jowa1: 1jow A:9-148 [66998]
   Other proteins in same PDB: d1jowb_

Details for d1jowa1

PDB Entry: 1jow, 3.1 Å

PDB Description: Crystal structure of a complex of human CDK6 and a viral cyclin

SCOP Domain Sequences for d1jowa1:

Sequence, based on SEQRES records:

>d1jowa1 a.74.1.1 (A:9-148) Viral cyclin {Herpes virus saimiri}
nrakidsttmkdprvlnnlklrelllpkftslweiqtevtvdnrtilltwmhllcesfel
dksvfplsvsildrylckkqgtkktlqkigaacvligskirtvkpmtvskltylscdcft
nlelinqekdilealkwdte

Sequence, based on observed residues (ATOM records):

>d1jowa1 a.74.1.1 (A:9-148) Viral cyclin {Herpes virus saimiri}
nrakidsttmkdprvlnnlklrelllpkftslweiqtevtvdnrtilltwmhllcesfel
dksvfplsvsildrylckkqgtkktlqkigaacvligskirtvkpmtvskltylsftnle
linqekdilealkwdte

Timeline for d1jowa1:

• d1jowa1 first appeared in SCOP 1.59
  
• d1jowa1 appears in SCOP 1.63
  
• d1jowa1 appears in SCOP 1.67
  
• d1jowa1 appears in the current release, SCOPe 2.08