Lineage for d1joja_ (1joj A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2049732Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2049733Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2049734Family b.29.1.1: Legume lectins [49900] (5 proteins)
  6. 2049738Protein Concanavalin A [49901] (4 species)
    natural circle permutation: the "old" N- and C-termini are linked with a peptide bond, whereas the "new" ones correspond to a cleaved loop
  7. 2049759Species Jack bean (Canavalia ensiformis) [TaxId:3823] [49902] (59 PDB entries)
    Uniprot P81461
  8. 2049889Domain d1joja_: 1joj A: [66994]
    complexed with a hexapeptide
    complexed with ca, mn

Details for d1joja_

PDB Entry: 1joj (more details), 3 Å

PDB Description: concanavalin a-hexapeptide complex
PDB Compounds: (A:) concanavalin a

SCOPe Domain Sequences for d1joja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1joja_ b.29.1.1 (A:) Concanavalin A {Jack bean (Canavalia ensiformis) [TaxId: 3823]}
adtivaveldtypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvdkr
lsavvsypnadsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnst
hetnalhfmfnqfskdqkdlilqgdattgtdgnleltrvssngspqgssvgralfyapvh
iwessavvasfeatftflikspdshpadgiaffisnidssipsgstgrllglfpdan

SCOPe Domain Coordinates for d1joja_:

Click to download the PDB-style file with coordinates for d1joja_.
(The format of our PDB-style files is described here.)

Timeline for d1joja_: