Lineage for d1jnyb3 (1jny B:4-227)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2123292Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2123293Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2124192Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2124522Protein Elongation factor eEF-1alpha, N-terminal (G) domain [52631] (2 species)
    eukaryotic and archaeal homologue of EF-Tu
  7. 2124530Species Sulfolobus solfataricus [TaxId:2287] [69487] (2 PDB entries)
    Uniprot P35021
  8. 2124534Domain d1jnyb3: 1jny B:4-227 [66987]
    Other proteins in same PDB: d1jnya1, d1jnya2, d1jnyb1, d1jnyb2
    complexed with gdp

Details for d1jnyb3

PDB Entry: 1jny (more details), 1.8 Å

PDB Description: Crystal structure of Sulfolobus solfataricus elongation factor 1 alpha in complex with GDP
PDB Compounds: (B:) Elongation factor 1-alpha

SCOPe Domain Sequences for d1jnyb3:

Sequence, based on SEQRES records: (download)

>d1jnyb3 c.37.1.8 (B:4-227) Elongation factor eEF-1alpha, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]}
kphlnlivighvdhgkstlvgrllmdrgfidektvkeaeeaakklgkesekfaflldrlk
eerergvtinltfmrfetkkyfftiidapghrdfvknmitgasqadaailvvsakkgeye
agmsvegqtrehiilaktmgldqlivavnkmdlteppydekrykeivdqvskfmrsygfn
tnkvrfvpvvapsgdnithksenmkwyngptleeyldqlelppk

Sequence, based on observed residues (ATOM records): (download)

>d1jnyb3 c.37.1.8 (B:4-227) Elongation factor eEF-1alpha, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]}
kphlnlivighvdhgkstlvgrllmdrgfidektvkeaeeaakklgkesekfaflldrmr
fetkkyfftiidapghrdfvknmitgasqadaailvvsakkgeyeagmsvegqtrehiil
aktmgldqlivavnkmdlteppydekrykeivdqvskfmrsygfntnkvrfvpvvapsgd
nithksenmkwyngptleeyldqlelppk

SCOPe Domain Coordinates for d1jnyb3:

Click to download the PDB-style file with coordinates for d1jnyb3.
(The format of our PDB-style files is described here.)

Timeline for d1jnyb3: