Class b: All beta proteins [48724] (177 folds) |
Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (2 families) probably related to the second domain and its superfamiy by a circular permutation |
Family b.44.1.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50466] (7 proteins) |
Protein Elongation factor eEF-1alpha, C-terminal domain [50472] (2 species) eukaryotic and archaeal homologue of EF-Tu |
Species Sulfolobus solfataricus [TaxId:2287] [69277] (2 PDB entries) Uniprot P35021 |
Domain d1jnyb2: 1jny B:323-430 [66986] Other proteins in same PDB: d1jnya1, d1jnya3, d1jnyb1, d1jnyb3 complexed with gdp |
PDB Entry: 1jny (more details), 1.8 Å
SCOPe Domain Sequences for d1jnyb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jnyb2 b.44.1.1 (B:323-430) Elongation factor eEF-1alpha, C-terminal domain {Sulfolobus solfataricus [TaxId: 2287]} adeftariivvwhptalangytpvlhvhtasvacrvselvskldprtgqeaeknpqflkq gdvaivkfkpikplcvekynefpplgrfamrdmgktvgvgiivdvkpa
Timeline for d1jnyb2: