Lineage for d1jnyb1 (1jny B:228-322)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 111309Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (3 superfamilies)
  4. 111320Superfamily b.43.3: Translation proteins [50447] (2 families) (S)
  5. 111321Family b.43.3.1: Elongation factors [50448] (4 proteins)
  6. 111322Protein Elongation factor eEF-1alpha, domain 2 [50454] (2 species)
  7. 111323Species Archaeon Sulfolobus solfataricus [TaxId:2287] [69276] (1 PDB entry)
  8. 111325Domain d1jnyb1: 1jny B:228-322 [66985]
    Other proteins in same PDB: d1jnya2, d1jnya3, d1jnyb2, d1jnyb3

Details for d1jnyb1

PDB Entry: 1jny (more details), 1.8 Å

PDB Description: Crystal structure of Sulfolobus solfataricus elongation factor 1 alpha in complex with GDP

SCOP Domain Sequences for d1jnyb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jnyb1 b.43.3.1 (B:228-322) Elongation factor eEF-1alpha, domain 2 {Archaeon Sulfolobus solfataricus}
pvdkplripiqdvysisgvgtvpvgrvesgvlkvgdkivfmpagkvgevrsiethhtkmd
kaepgdnigfnvrgvekkdikrgdvvghpnnpptv

SCOP Domain Coordinates for d1jnyb1:

Click to download the PDB-style file with coordinates for d1jnyb1.
(The format of our PDB-style files is described here.)

Timeline for d1jnyb1: