Lineage for d1jnya3 (1jny A:4-227)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 829350Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 829351Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) (S)
    division into families based on beta-sheet topologies
  5. 829945Family c.37.1.8: G proteins [52592] (78 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 830166Protein Elongation factor eEF-1alpha, N-terminal (G) domain [52631] (2 species)
    eukaryotic and archaeal homologue of EF-Tu
  7. 830167Species Archaeon Sulfolobus solfataricus [TaxId:2287] [69487] (2 PDB entries)
    Uniprot P35021
  8. 830168Domain d1jnya3: 1jny A:4-227 [66984]
    Other proteins in same PDB: d1jnya1, d1jnya2, d1jnyb1, d1jnyb2

Details for d1jnya3

PDB Entry: 1jny (more details), 1.8 Å

PDB Description: Crystal structure of Sulfolobus solfataricus elongation factor 1 alpha in complex with GDP
PDB Compounds: (A:) Elongation factor 1-alpha

SCOP Domain Sequences for d1jnya3:

Sequence, based on SEQRES records: (download)

>d1jnya3 c.37.1.8 (A:4-227) Elongation factor eEF-1alpha, N-terminal (G) domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]}
kphlnlivighvdhgkstlvgrllmdrgfidektvkeaeeaakklgkesekfaflldrlk
eerergvtinltfmrfetkkyfftiidapghrdfvknmitgasqadaailvvsakkgeye
agmsvegqtrehiilaktmgldqlivavnkmdlteppydekrykeivdqvskfmrsygfn
tnkvrfvpvvapsgdnithksenmkwyngptleeyldqlelppk

Sequence, based on observed residues (ATOM records): (download)

>d1jnya3 c.37.1.8 (A:4-227) Elongation factor eEF-1alpha, N-terminal (G) domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]}
kphlnlivighvdhgkstlvgrllmdrgfidektvkeaeeaakklgkesekfaflldrlk
eemrfetkkyfftiidapghrdfvknmitgasqadaailvvsakkgeyeagmsvegqtre
hiilaktmgldqlivavnkmdlteppydekrykeivdqvskfmrsygfntnkvrfvpvva
psgdnithksenmkwyngptleeyldqlelppk

SCOP Domain Coordinates for d1jnya3:

Click to download the PDB-style file with coordinates for d1jnya3.
(The format of our PDB-style files is described here.)

Timeline for d1jnya3: