SCOP 1.61: Domain d1jnrc3: 1jnr C:257-401

Lineage for d1jnrc3 (1jnr C:257-401)

1. Root: SCOP 1.61

2. Class d: Alpha and beta proteins (a+b) [53931] (212 folds)

3. Fold d.168: Succinate dehydrogenase/fumarate reductase catalytic domain [56424] (1 superfamily)

4. Superfamily d.168.1: Succinate dehydrogenase/fumarate reductase catalytic domain [56425] (1 family)

5. Family d.168.1.1: Succinate dehydrogenase/fumarate reductase catalytic domain [56426] (4 proteins)

6. Protein Adenylylsulfate reductase A subunit [69852] (1 species)

7. Species Archaeon Archaeoglobus fulgidus [TaxId:2234] [69853] (2 PDB entries)

8. Domain d1jnrc3: 1jnr C:257-401 [66972]
   Other proteins in same PDB: d1jnra1, d1jnra2, d1jnrb_, d1jnrc1, d1jnrc2, d1jnrd_

Details for d1jnrc3

PDB Entry: 1jnr, 1.6 Å

PDB Description: structure of adenylylsulfate reductase from the hyperthermophilic archaeoglobus fulgidus at 1.6 resolution

SCOP Domain Sequences for d1jnrc3:

Sequence; same for both SEQRES and ATOM records:

>d1jnrc3 d.168.1.1 (C:257-401) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus}
fehrfipfrfkdgygpvgawflffkckaknaygeeyiktraaelekykpygaaqpiptpl
rnhqvmleimdgnqpiymhteealaelaggdkkklkhiyeeafedfldmtvsqallwacq
nidpqeqpseaapaepyimgshsge

Timeline for d1jnrc3:

• d1jnrc3 first appeared in SCOP 1.59
  
• d1jnrc3 appears in SCOP 1.63
  
• d1jnrc3 appears in the current release, SCOPe 2.08