Lineage for d1jnrc2 (1jnr C:2-256,C:402-502)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 119015Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
  4. 119016Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families) (S)
  5. 119166Family c.3.1.4: Succinate dehydrogenase/fumarate reductase N-terminal domain [51934] (4 proteins)
  6. 119167Protein Adenylylsulfate reductase A subunit [69425] (1 species)
  7. 119168Species Archaeon Archaeoglobus fulgidus [TaxId:2234] [69426] (1 PDB entry)
  8. 119170Domain d1jnrc2: 1jnr C:2-256,C:402-502 [66971]
    Other proteins in same PDB: d1jnra1, d1jnra3, d1jnrb_, d1jnrc1, d1jnrc3, d1jnrd_

Details for d1jnrc2

PDB Entry: 1jnr (more details), 1.6 Å

PDB Description: structure of adenylylsulfate reductase from the hyperthermophilic archaeoglobus fulgidus at 1.6 resolution

SCOP Domain Sequences for d1jnrc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jnrc2 c.3.1.4 (C:2-256,C:402-502) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus}
vyypkkyelykadevptevvetdiliigggfsgcgaayeaaywaklgglkvtlvekaave
rsgavaqglsaintyidltgrserqntledyvryvtldmmglaredlvadyarhvdgtvh
lfekwglpiwktpdgkyvregqwqimihgesykpiiaeaakmavgeeniyervfifellk
dnndpnavagavgfsvrepkfyvfkakavilatggatllfrprstgeaagrtwyaifdtg
sgyymglkagamltqXagfwvcgpedlmpeeyaklfplkynrmttvkglfaigdcaganp
hkfssgsftegriaakaavrfileqkpnpeiddavveelkkkayapmerfmqykdls

SCOP Domain Coordinates for d1jnrc2:

Click to download the PDB-style file with coordinates for d1jnrc2.
(The format of our PDB-style files is described here.)

Timeline for d1jnrc2: