Class a: All alpha proteins [46456] (289 folds) |
Fold a.7: Spectrin repeat-like [46965] (16 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down |
Superfamily a.7.3: Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain [46977] (1 family) |
Family a.7.3.1: Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain [46978] (4 proteins) |
Protein Adenylylsulfate reductase A subunit [68978] (1 species) |
Species Archaeoglobus fulgidus [TaxId:2234] [68979] (2 PDB entries) |
Domain d1jnrc1: 1jnr C:503-643 [66970] Other proteins in same PDB: d1jnra2, d1jnra3, d1jnrb_, d1jnrc2, d1jnrc3, d1jnrd_ complexed with fad, gol, sf4 |
PDB Entry: 1jnr (more details), 1.6 Å
SCOPe Domain Sequences for d1jnrc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jnrc1 a.7.3.1 (C:503-643) Adenylylsulfate reductase A subunit {Archaeoglobus fulgidus [TaxId: 2234]} taddvnpeyilpwqglvrlqkimdeyaagiatiyktnekmlqralellaflkedleklaa rdlhelmrawelvhrvwtaeahvrhmlfrketrwpgyyyrtdypelndeewkcfvcskyd aekdewtfekvpyvqviewsf
Timeline for d1jnrc1: