SCOP 1.59: Domain d1jnrc1: 1jnr C:503-643

Lineage for d1jnrc1 (1jnr C:503-643)

1. Root: SCOP 1.59

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.7: Spectrin repeat-like [46965] (7 superfamilies)

4. Superfamily a.7.3: Succinate dehydrogenase/fumarate reductase C-terminal domain [46977] (1 family)

5. Family a.7.3.1: Succinate dehydrogenase/fumarate reductase C-terminal domain [46978] (3 proteins)

6. Protein Adenylylsulfate reductase A subunit [68978] (1 species)

7. Species Archaeon Archaeoglobus fulgidus [TaxId:2234] [68979] (1 PDB entry)

8. Domain d1jnrc1: 1jnr C:503-643 [66970]
   Other proteins in same PDB: d1jnra2, d1jnra3, d1jnrb_, d1jnrc2, d1jnrc3, d1jnrd_

Details for d1jnrc1

PDB Entry: 1jnr, 1.6 Å

PDB Description: structure of adenylylsulfate reductase from the hyperthermophilic archaeoglobus fulgidus at 1.6 resolution

SCOP Domain Sequences for d1jnrc1:

Sequence; same for both SEQRES and ATOM records:

>d1jnrc1 a.7.3.1 (C:503-643) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus}
taddvnpeyilpwqglvrlqkimdeyaagiatiyktnekmlqralellaflkedleklaa
rdlhelmrawelvhrvwtaeahvrhmlfrketrwpgyyyrtdypelndeewkcfvcskyd
aekdewtfekvpyvqviewsf

Timeline for d1jnrc1:

• d1jnrc1 is new in SCOP 1.59
  
• d1jnrc1 appears in SCOP 1.61
  
• d1jnrc1 appears in the current release, SCOPe 2.08