Lineage for d1jnrb_ (1jnr B:)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 257061Fold d.58: Ferredoxin-like [54861] (44 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 257062Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (5 families) (S)
  5. 257149Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (7 proteins)
    members of this "family" may be more closely related to other ferredoxins than to each other
  6. 257150Protein Adenylylsulfate reductase B subunit [69726] (1 species)
    includes N-terminal partly folded tail
  7. 257151Species Archaeon Archaeoglobus fulgidus [TaxId:2234] [69727] (2 PDB entries)
  8. 257152Domain d1jnrb_: 1jnr B: [66969]
    Other proteins in same PDB: d1jnra1, d1jnra2, d1jnra3, d1jnrc1, d1jnrc2, d1jnrc3

Details for d1jnrb_

PDB Entry: 1jnr (more details), 1.6 Å

PDB Description: structure of adenylylsulfate reductase from the hyperthermophilic archaeoglobus fulgidus at 1.6 resolution

SCOP Domain Sequences for d1jnrb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jnrb_ d.58.1.5 (B:) Adenylylsulfate reductase B subunit {Archaeon Archaeoglobus fulgidus}
psfvnpekcdgckalertaceyicpndlmtldkekmkaynrepdmcwecyscvkmcpqga
idvrgyvdysplggacvpmrgtsdimwtvkyrngkvlrfkfairttpwgsiqpfegfpep
teealksellagepeiigtsefpqvkkka

SCOP Domain Coordinates for d1jnrb_:

Click to download the PDB-style file with coordinates for d1jnrb_.
(The format of our PDB-style files is described here.)

Timeline for d1jnrb_: