Lineage for d1jnra3 (1jnr A:257-401)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 264398Fold d.168: Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain [56424] (1 superfamily)
    unusual fold
  4. 264399Superfamily d.168.1: Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain [56425] (1 family) (S)
  5. 264400Family d.168.1.1: Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain [56426] (5 proteins)
  6. 264401Protein Adenylylsulfate reductase A subunit [69852] (1 species)
  7. 264402Species Archaeon Archaeoglobus fulgidus [TaxId:2234] [69853] (2 PDB entries)
  8. 264403Domain d1jnra3: 1jnr A:257-401 [66968]
    Other proteins in same PDB: d1jnra1, d1jnra2, d1jnrb_, d1jnrc1, d1jnrc2, d1jnrd_

Details for d1jnra3

PDB Entry: 1jnr (more details), 1.6 Å

PDB Description: structure of adenylylsulfate reductase from the hyperthermophilic archaeoglobus fulgidus at 1.6 resolution

SCOP Domain Sequences for d1jnra3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jnra3 d.168.1.1 (A:257-401) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus}
fehrfipfrfkdgygpvgawflffkckaknaygeeyiktraaelekykpygaaqpiptpl
rnhqvmleimdgnqpiymhteealaelaggdkkklkhiyeeafedfldmtvsqallwacq
nidpqeqpseaapaepyimgshsge

SCOP Domain Coordinates for d1jnra3:

Click to download the PDB-style file with coordinates for d1jnra3.
(The format of our PDB-style files is described here.)

Timeline for d1jnra3: