Lineage for d1jnra2 (1jnr A:2-256,A:402-502)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2096453Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 2096454Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) (S)
  5. 2096891Family c.3.1.4: Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain [51934] (5 protein domains)
  6. 2096892Protein Adenylylsulfate reductase A subunit [69425] (1 species)
  7. 2096893Species Archaeoglobus fulgidus [TaxId:2234] [69426] (2 PDB entries)
  8. 2096894Domain d1jnra2: 1jnr A:2-256,A:402-502 [66967]
    Other proteins in same PDB: d1jnra1, d1jnra3, d1jnrb_, d1jnrc1, d1jnrc3, d1jnrd_
    complexed with fad, gol, sf4

Details for d1jnra2

PDB Entry: 1jnr (more details), 1.6 Å

PDB Description: structure of adenylylsulfate reductase from the hyperthermophilic archaeoglobus fulgidus at 1.6 resolution
PDB Compounds: (A:) adenylylsulfate reductase

SCOPe Domain Sequences for d1jnra2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jnra2 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reductase A subunit {Archaeoglobus fulgidus [TaxId: 2234]}
vyypkkyelykadevptevvetdiliigggfsgcgaayeaaywaklgglkvtlvekaave
rsgavaqglsaintyidltgrserqntledyvryvtldmmglaredlvadyarhvdgtvh
lfekwglpiwktpdgkyvregqwqimihgesykpiiaeaakmavgeeniyervfifellk
dnndpnavagavgfsvrepkfyvfkakavilatggatllfrprstgeaagrtwyaifdtg
sgyymglkagamltqXagfwvcgpedlmpeeyaklfplkynrmttvkglfaigdcaganp
hkfssgsftegriaakaavrfileqkpnpeiddavveelkkkayapmerfmqykdls

SCOPe Domain Coordinates for d1jnra2:

Click to download the PDB-style file with coordinates for d1jnra2.
(The format of our PDB-style files is described here.)

Timeline for d1jnra2: