SCOPe 2.06: Domain d1jnpb_: 1jnp B:

Lineage for d1jnpb_ (1jnp B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.63: Oncogene products [50903] (1 superfamily)
   barrel, closed; n=8, S=10; one overside connection

4. Superfamily b.63.1: Oncogene products [50904] (1 family)
   duplication: N- and C-terminal halves are related by pseudo dyad
   automatically mapped to Pfam PF01840

5. Family b.63.1.1: Oncogene products [50905] (2 proteins)

6. Protein p14-TCL1 [50906] (2 species)
   an oncogene product involved in T-cell prolymphocytic leukemia

7. Species Mouse (Mus musculus) [TaxId:10090] [69303] (1 PDB entry)

8. Domain d1jnpb_: 1jnp B: [66965]

Details for d1jnpb_

PDB Entry: 1jnp, 2.5 Å

PDB Description: crystal structure of murine tcl1 at 2.5 resolution

PDB Compounds: (B:) T-cell leukemia/lymphoma protein 1a

SCOPe Domain Sequences for d1jnpb_:

Sequence; same for both SEQRES and ATOM records:

>d1jnpb_ b.63.1.1 (B:) p14-TCL1 {Mouse (Mus musculus) [TaxId: 10090]}
raetpahpnrlwiwekhvyldefrrswlpvviksnekfqvilrqedvtlgeamspsqlvp
yelplmwqlypkdryrsadsmywqilyhikfrdvedmllel

Timeline for d1jnpb_:

• d1jnpb_ first appeared in SCOP 1.59
  
• d1jnpb_ appears in SCOPe 2.05
  
• d1jnpb_ appears in SCOPe 2.07
  
• d1jnpb_ appears in the current release, SCOPe 2.08