SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1jnpa_ (1jnp A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2064652Fold b.63: Oncogene products [50903] (1 superfamily)
    barrel, closed; n=8, S=10; one overside connection
  4. 2064653Superfamily b.63.1: Oncogene products [50904] (1 family) (S)
    duplication: N- and C-terminal halves are related by pseudo dyad
    automatically mapped to Pfam PF01840
  5. 2064654Family b.63.1.1: Oncogene products [50905] (2 protein domains)
  6. 2064660Protein p14-TCL1 [50906] (2 species)
    an oncogene product involved in T-cell prolymphocytic leukemia
  7. 2064663Species Mouse (Mus musculus) [TaxId:10090] [69303] (1 PDB entry)
  8. 2064664Domain d1jnpa_: 1jnp A: [66964]

Details for d1jnpa_

PDB Entry: 1jnp (more details), 2.5 Å

PDB Description: Crystal Structure of Murine Tcl1 at 2.5 Resolution
PDB Compounds: (A:) T-cell leukemia/lymphoma protein 1a

SCOPe Domain Sequences for d1jnpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jnpa_ b.63.1.1 (A:) p14-TCL1 {Mouse (Mus musculus) [TaxId: 10090]}
raetpahpnrlwiwekhvyldefrrswlpvviksnekfqvilrqedvtlgeamspsqlvp
yelplmwqlypkdryrsadsmywqilyhikfrdvedmllel

SCOPe Domain Coordinates for d1jnpa_:

Click to download the PDB-style file with coordinates for d1jnpa_.
(The format of our PDB-style files is described here.)

Timeline for d1jnpa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1jnpb_