SCOPe 2.08: Domain d1jnpa_: 1jnp A:

Lineage for d1jnpa_ (1jnp A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.63: Oncogene products [50903] (1 superfamily)
   barrel, closed; n=8, S=10; one overside connection

4. Superfamily b.63.1: Oncogene products [50904] (1 family)
   duplication: N- and C-terminal halves are related by pseudo dyad
   automatically mapped to Pfam PF01840

5. Family b.63.1.1: Oncogene products [50905] (2 proteins)

6. Protein p14-TCL1 [50906] (2 species)
   an oncogene product involved in T-cell prolymphocytic leukemia

7. Species Mouse (Mus musculus) [TaxId:10090] [69303] (1 PDB entry)

8. Domain d1jnpa_: 1jnp A: [66964]

Details for d1jnpa_

PDB Entry: 1jnp, 2.5 Å

PDB Description: crystal structure of murine tcl1 at 2.5 resolution

PDB Compounds: (A:) T-cell leukemia/lymphoma protein 1a

SCOPe Domain Sequences for d1jnpa_:

Sequence; same for both SEQRES and ATOM records:

>d1jnpa_ b.63.1.1 (A:) p14-TCL1 {Mouse (Mus musculus) [TaxId: 10090]}
raetpahpnrlwiwekhvyldefrrswlpvviksnekfqvilrqedvtlgeamspsqlvp
yelplmwqlypkdryrsadsmywqilyhikfrdvedmllel

Timeline for d1jnpa_:

• d1jnpa_ first appeared in SCOP 1.59
  
• d1jnpa_ appears in SCOPe 2.07