SCOP 1.71: Domain d1jnnl2: 1jnn L:108-211

Lineage for d1jnnl2 (1jnn L:108-211)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88567] (284 PDB entries)

8. Domain d1jnnl2: 1jnn L:108-211 [66963]
   Other proteins in same PDB: d1jnnh1, d1jnnh2, d1jnnl1
   part of anti-estradiol Fab 17E12E5
   complexed with est

Details for d1jnnl2

PDB Entry: 1jnn, 3.2 Å

PDB Description: Crystal Structure of Fab-Estradiol Complexes

SCOP Domain Sequences for d1jnnl2:

Sequence; same for both SEQRES and ATOM records:

>d1jnnl2 b.1.1.2 (L:108-211) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus)}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnr

Timeline for d1jnnl2:

• d1jnnl2 first appeared in SCOP 1.59
  
• d1jnnl2 appears in SCOP 1.69
  
• d1jnnl2 appears in SCOP 1.73
  
• d1jnnl2 appears in the current release, SCOPe 2.08