Lineage for d1jnnh2 (1jnn H:115-229)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 655111Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
  7. 655348Species Mouse (Mus musculus) [TaxId:10090] [88576] (330 PDB entries)
  8. 655697Domain d1jnnh2: 1jnn H:115-229 [66961]
    Other proteins in same PDB: d1jnnh1, d1jnnl1, d1jnnl2
    part of anti-estradiol Fab 17E12E5
    complexed with est

Details for d1jnnh2

PDB Entry: 1jnn (more details), 3.2 Å

PDB Description: Crystal Structure of Fab-Estradiol Complexes
PDB Compounds: (H:) monoclonal anti-estradiol 17e12e5 immunoglobulin gamma-1 chain

SCOP Domain Sequences for d1jnnh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jnnh2 b.1.1.2 (H:115-229) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivpr

SCOP Domain Coordinates for d1jnnh2:

Click to download the PDB-style file with coordinates for d1jnnh2.
(The format of our PDB-style files is described here.)

Timeline for d1jnnh2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jnnh1