Lineage for d1jnll1 (1jnl L:1-107)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 287097Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (21 proteins)
  6. 287738Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogeneous CDRs are listed as engineered species
  7. 288075Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88531] (146 PDB entries)
  8. 288207Domain d1jnll1: 1jnl L:1-107 [66958]
    Other proteins in same PDB: d1jnlh1, d1jnlh2, d1jnll2
    part of anti-estradiol Fab 17E12E5

Details for d1jnll1

PDB Entry: 1jnl (more details), 3 Å

PDB Description: Crystal Structure of Fab-Estradiol Complexes

SCOP Domain Sequences for d1jnll1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jnll1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4}
qivmtqtpaslsasvgetvtitcrasgniynylawyqqkqgkspqllvynaktlvdgvpl
rfsgsgsgtqyslkinslqpedfgnyychhfwntpytfgggtkleik

SCOP Domain Coordinates for d1jnll1:

Click to download the PDB-style file with coordinates for d1jnll1.
(The format of our PDB-style files is described here.)

Timeline for d1jnll1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jnll2