SCOP 1.75: Domain d1jnlh1: 1jnl H:1-114

Lineage for d1jnlh1 (1jnl H:1-114)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 3.1 [TaxId:10090] [88551] (31 PDB entries)
   SQ NA # natural chimera; best hits are: Uniprot P01751 (Ig heavy chain V region B1-8/186-2) and Uniprot P01864 (Ig gamma-2A chain C region secreted form)

8. Domain d1jnlh1: 1jnl H:1-114 [66956]
   Other proteins in same PDB: d1jnlh2, d1jnll1, d1jnll2
   part of anti-estradiol Fab 17E12E5

Details for d1jnlh1

PDB Entry: 1jnl, 3 Å

PDB Description: Crystal Structure of Fab-Estradiol Complexes

PDB Compounds: (H:) monoclonal anti-estradiol 17e12e5 immunoglobulin gamma-1 chain

SCOP Domain Sequences for d1jnlh1:

Sequence; same for both SEQRES and ATOM records:

>d1jnlh1 b.1.1.1 (H:1-114) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.1 [TaxId: 10090]}
evqlqqsgaelvkpgasvrlscsasgfnikdtymfwvkqrpeqgldwigrinpangisky
dprfqgkatltadtssntaylqldnltsedtavyycaiekdlpwgqgtlvtvsv

Timeline for d1jnlh1:

• d1jnlh1 first appeared in SCOP 1.59
  
• d1jnlh1 appears in SCOP 1.73
  
• d1jnlh1 appears in SCOPe 2.01
  
• d1jnlh1 appears in the current release, SCOPe 2.08