SCOPe 2.04: Domain d1jnhg2: 1jnh G:112-211

Lineage for d1jnhg2 (1jnh G:112-211)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin light chain lambda constant domain, CL-lambda [88570] (3 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88571] (21 PDB entries)
   Uniprot Q8N355 20-230 # 94% sequence identity; natural chimera: antibody light chain (Fab HYB3)

8. Domain d1jnhg2: 1jnh G:112-211 [66952]
   Other proteins in same PDB: d1jnha1, d1jnhb1, d1jnhb2, d1jnhc1, d1jnhd1, d1jnhd2, d1jnhe1, d1jnhf1, d1jnhf2, d1jnhg1, d1jnhh1, d1jnhh2
   part of anti-estradiol Fab 10G6D6
   complexed with eco

Details for d1jnhg2

PDB Entry: 1jnh, 2.85 Å

PDB Description: crystal structure of fab-estradiol complexes

PDB Compounds: (G:) monoclonal anti-estradiol 10g6d6 immunoglobulin lambda chain

SCOPe Domain Sequences for d1jnhg2:

Sequence; same for both SEQRES and ATOM records:

>d1jnhg2 b.1.1.2 (G:112-211) Immunoglobulin light chain lambda constant domain, CL-lambda {Mouse (Mus musculus) [TaxId: 10090]}
ksspsvtlfppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpskqsn
nkymassyltltarawerhssyscqvtheghtvekslsaa

Timeline for d1jnhg2:

• d1jnhg2 first appeared in SCOP 1.59
  
• d1jnhg2 appears in SCOPe 2.03
  
• d1jnhg2 appears in SCOPe 2.05
  
• d1jnhg2 appears in the current release, SCOPe 2.08