Lineage for d1jnhg2 (1jnh G:112-211)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 362616Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 364354Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 366115Protein Immunoglobulin light chain lambda constant domain, CL-lambda [88570] (3 species)
  7. 366194Species Mouse (Mus musculus) [TaxId:10090] [88571] (20 PDB entries)
  8. 366210Domain d1jnhg2: 1jnh G:112-211 [66952]
    Other proteins in same PDB: d1jnha1, d1jnhb1, d1jnhb2, d1jnhc1, d1jnhd1, d1jnhd2, d1jnhe1, d1jnhf1, d1jnhf2, d1jnhg1, d1jnhh1, d1jnhh2
    part of anti-estradiol Fab 10G6D6
    complexed with eco

Details for d1jnhg2

PDB Entry: 1jnh (more details), 2.85 Å

PDB Description: crystal structure of fab-estradiol complexes

SCOP Domain Sequences for d1jnhg2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jnhg2 b.1.1.2 (G:112-211) Immunoglobulin light chain lambda constant domain, CL-lambda {Mouse (Mus musculus)}
ksspsvtlfppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpskqsn
nkymassyltltarawerhssyscqvtheghtvekslsaa

SCOP Domain Coordinates for d1jnhg2:

Click to download the PDB-style file with coordinates for d1jnhg2.
(The format of our PDB-style files is described here.)

Timeline for d1jnhg2: