Lineage for d1jnhg1 (1jnh G:1-108)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2741614Protein Immunoglobulin light chain lambda variable domain, VL-lambda [88534] (9 species)
    VL-lambda domains of human antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the human genome; mouse VL-lambda domains belong to a single germline family
  7. 2741706Species Mouse (Mus musculus) [TaxId:10090] [88541] (36 PDB entries)
  8. 2741750Domain d1jnhg1: 1jnh G:1-108 [66951]
    Other proteins in same PDB: d1jnha2, d1jnhb1, d1jnhb2, d1jnhc2, d1jnhd1, d1jnhd2, d1jnhe2, d1jnhf1, d1jnhf2, d1jnhg2, d1jnhh1, d1jnhh2
    part of anti-estradiol Fab 10G6D6
    complexed with eco

Details for d1jnhg1

PDB Entry: 1jnh (more details), 2.85 Å

PDB Description: crystal structure of fab-estradiol complexes
PDB Compounds: (G:) monoclonal anti-estradiol 10G6D6 Fab light chain

SCOPe Domain Sequences for d1jnhg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jnhg1 b.1.1.1 (G:1-108) Immunoglobulin light chain lambda variable domain, VL-lambda {Mouse (Mus musculus) [TaxId: 10090]}
qavvtqesalttspgetvtltcrsssgaittshyanwiqekpdhlftglisgtnnrapgv
parfsgsligdkaaltitgaqtedeaiyicalwfsnqfifgsgtkvtv

SCOPe Domain Coordinates for d1jnhg1:

Click to download the PDB-style file with coordinates for d1jnhg1.
(The format of our PDB-style files is described here.)

Timeline for d1jnhg1: