| Class b: All beta proteins [48724] (126 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins) |
| Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species) |
| Species Mouse (Mus musculus) [TaxId:10090] [88576] (237 PDB entries) |
| Domain d1jnhf2: 1jnh F:121-217 [66950] Other proteins in same PDB: d1jnha1, d1jnha2, d1jnhb1, d1jnhc1, d1jnhc2, d1jnhd1, d1jnhe1, d1jnhe2, d1jnhf1, d1jnhg1, d1jnhg2, d1jnhh1 |
PDB Entry: 1jnh (more details), 2.85 Å
SCOP Domain Sequences for d1jnhf2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jnhf2 b.1.1.2 (F:121-217) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
ttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvswntgslssgvhtfpavlqsdly
tlsssvtvpsstwpsetvtcnvahpasstkvdkkivp
Timeline for d1jnhf2: