Lineage for d1jnhf2 (1jnh F:121-217)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 288543Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 289100Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
  7. 289192Species Mouse (Mus musculus) [TaxId:10090] [88576] (237 PDB entries)
  8. 289398Domain d1jnhf2: 1jnh F:121-217 [66950]
    Other proteins in same PDB: d1jnha1, d1jnha2, d1jnhb1, d1jnhc1, d1jnhc2, d1jnhd1, d1jnhe1, d1jnhe2, d1jnhf1, d1jnhg1, d1jnhg2, d1jnhh1

Details for d1jnhf2

PDB Entry: 1jnh (more details), 2.85 Å

PDB Description: crystal structure of fab-estradiol complexes

SCOP Domain Sequences for d1jnhf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jnhf2 b.1.1.2 (F:121-217) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
ttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvswntgslssgvhtfpavlqsdly
tlsssvtvpsstwpsetvtcnvahpasstkvdkkivp

SCOP Domain Coordinates for d1jnhf2:

Click to download the PDB-style file with coordinates for d1jnhf2.
(The format of our PDB-style files is described here.)

Timeline for d1jnhf2: