SCOP 1.65: Domain d1jnhf2: 1jnh F:121-217

Lineage for d1jnhf2 (1jnh F:121-217)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88576] (237 PDB entries)

8. Domain d1jnhf2: 1jnh F:121-217 [66950]
   Other proteins in same PDB: d1jnha1, d1jnha2, d1jnhb1, d1jnhc1, d1jnhc2, d1jnhd1, d1jnhe1, d1jnhe2, d1jnhf1, d1jnhg1, d1jnhg2, d1jnhh1

Details for d1jnhf2

PDB Entry: 1jnh, 2.85 Å

PDB Description: crystal structure of fab-estradiol complexes

SCOP Domain Sequences for d1jnhf2:

Sequence; same for both SEQRES and ATOM records:

>d1jnhf2 b.1.1.2 (F:121-217) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
ttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvswntgslssgvhtfpavlqsdly
tlsssvtvpsstwpsetvtcnvahpasstkvdkkivp

Timeline for d1jnhf2:

• d1jnhf2 first appeared in SCOP 1.59
  
• d1jnhf2 appears in SCOP 1.63
  
• d1jnhf2 appears in SCOP 1.67
  
• d1jnhf2 appears in the current release, SCOPe 2.08