Class b: All beta proteins [48724] (141 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins) |
Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species) |
Species Mouse (Mus musculus) [TaxId:10090] [88576] (287 PDB entries) |
Domain d1jnhb2: 1jnh B:121-217 [66942] Other proteins in same PDB: d1jnha1, d1jnha2, d1jnhb1, d1jnhc1, d1jnhc2, d1jnhd1, d1jnhe1, d1jnhe2, d1jnhf1, d1jnhg1, d1jnhg2, d1jnhh1 |
PDB Entry: 1jnh (more details), 2.85 Å
SCOP Domain Sequences for d1jnhb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jnhb2 b.1.1.2 (B:121-217) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)} ttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvswntgslssgvhtfpavlqsdly tlsssvtvpsstwpsetvtcnvahpasstkvdkkivp
Timeline for d1jnhb2: