SCOP 1.63: Domain d1jnhb2: 1jnh B:121-217

Lineage for d1jnhb2 (1jnh B:121-217)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species)

7. Species Anti-estradiol Fab 10G6D6, (mouse), lambda L chain [69155] (2 PDB entries)

8. Domain d1jnhb2: 1jnh B:121-217 [66942]
   Other proteins in same PDB: d1jnha1, d1jnhb1, d1jnhc1, d1jnhd1, d1jnhe1, d1jnhf1, d1jnhg1, d1jnhh1

Details for d1jnhb2

PDB Entry: 1jnh, 2.85 Å

PDB Description: crystal structure of fab-estradiol complexes

SCOP Domain Sequences for d1jnhb2:

Sequence; same for both SEQRES and ATOM records:

>d1jnhb2 b.1.1.2 (B:121-217) Immunoglobulin (constant domains of L and H chains) {Anti-estradiol Fab 10G6D6, (mouse), lambda L chain}
ttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvswntgslssgvhtfpavlqsdly
tlsssvtvpsstwpsetvtcnvahpasstkvdkkivp

Timeline for d1jnhb2:

• d1jnhb2 first appeared in SCOP 1.59
  
• d1jnhb2 appears in SCOP 1.61
  
• d1jnhb2 appears in SCOP 1.65
  
• d1jnhb2 appears in the current release, SCOPe 2.08