![]() | Class b: All beta proteins [48724] (141 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins) |
![]() | Protein Immunoglobulin light chain lambda constant domain, CL-lambda [88570] (3 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [88571] (20 PDB entries) |
![]() | Domain d1jnha2: 1jnh A:112-211 [66940] Other proteins in same PDB: d1jnha1, d1jnhb1, d1jnhb2, d1jnhc1, d1jnhd1, d1jnhd2, d1jnhe1, d1jnhf1, d1jnhf2, d1jnhg1, d1jnhh1, d1jnhh2 |
PDB Entry: 1jnh (more details), 2.85 Å
SCOP Domain Sequences for d1jnha2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jnha2 b.1.1.2 (A:112-211) Immunoglobulin light chain lambda constant domain, CL-lambda {Mouse (Mus musculus)} ksspsvtlfppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpskqsn nkymassyltltarawerhssyscqvtheghtvekslsaa
Timeline for d1jnha2: