SCOP 1.63: Domain d1jn6a1: 1jn6 A:1-108

Lineage for d1jn6a1 (1jn6 A:1-108)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)

7. Species Anti-estradiol Fab 10G6D6, (mouse), lambda L chain [69145] (2 PDB entries)

8. Domain d1jn6a1: 1jn6 A:1-108 [66923]
   Other proteins in same PDB: d1jn6a2, d1jn6b2

Details for d1jn6a1

PDB Entry: 1jn6, 2.7 Å

PDB Description: crystal structure of fab-estradiol complexes

SCOP Domain Sequences for d1jn6a1:

Sequence; same for both SEQRES and ATOM records:

>d1jn6a1 b.1.1.1 (A:1-108) Immunoglobulin (variable domains of L and H chains) {Anti-estradiol Fab 10G6D6, (mouse), lambda L chain}
qavvtqesalttspgetvtltcrsssgaittshyanwiqekpdhlftglisgtnnrapgv
parfsgsligdkaaltitgaqtedeaiyicalwfsnqfifgsgtkvtv

Timeline for d1jn6a1:

• d1jn6a1 first appeared in SCOP 1.59
  
• d1jn6a1 appears in SCOP 1.61
  
• d1jn6a1 appears in SCOP 1.65
  
• d1jn6a1 appears in the current release, SCOPe 2.08