![]() | Class b: All beta proteins [48724] (111 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies) |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (6 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins) |
![]() | Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species) |
![]() | Species Anti-estradiol Fab 10G6D6, (mouse), lambda L chain [69145] (2 PDB entries) |
![]() | Domain d1jn6a1: 1jn6 A:1-108 [66923] Other proteins in same PDB: d1jn6a2, d1jn6b2 |
PDB Entry: 1jn6 (more details), 2.7 Å
SCOP Domain Sequences for d1jn6a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jn6a1 b.1.1.1 (A:1-108) Immunoglobulin (variable domains of L and H chains) {Anti-estradiol Fab 10G6D6, (mouse), lambda L chain} qavvtqesalttspgetvtltcrsssgaittshyanwiqekpdhlftglisgtnnrapgv parfsgsligdkaaltitgaqtedeaiyicalwfsnqfifgsgtkvtv
Timeline for d1jn6a1: