Lineage for d1jn5b_ (1jn5 B:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1404616Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 1405093Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 1405117Family d.17.4.2: NTF2-like [54431] (6 proteins)
  6. 1405131Protein NTF2-like domain of Tip associating protein, TAP [69677] (1 species)
  7. 1405132Species Human (Homo sapiens) [TaxId:9606] [69678] (2 PDB entries)
  8. 1405134Domain d1jn5b_: 1jn5 B: [66922]
    Other proteins in same PDB: d1jn5a_

Details for d1jn5b_

PDB Entry: 1jn5 (more details), 2.8 Å

PDB Description: Structural basis for the recognition of a nucleoporin FG-repeat by the NTF2-like domain of TAP-p15 mRNA export factor
PDB Compounds: (B:) tap

SCOPe Domain Sequences for d1jn5b_:

Sequence, based on SEQRES records: (download)

>d1jn5b_ d.17.4.2 (B:) NTF2-like domain of Tip associating protein, TAP {Human (Homo sapiens) [TaxId: 9606]}
appckgsyfgtenlkslvlhflqqyyaiydsgdrqglldayhdgaccslsipfipqnpar
sslaeyfkdsrnvkklkdptlrfrllkhtrlnvvaflnelpktqhdvnsfvvdisaqtst
llcfsvngvfkevdgksrdslraftrtfiavpasnsglcivndelfvrnasseeiqrafa
mpaptp

Sequence, based on observed residues (ATOM records): (download)

>d1jn5b_ d.17.4.2 (B:) NTF2-like domain of Tip associating protein, TAP {Human (Homo sapiens) [TaxId: 9606]}
appckgsyfgtenlkslvlhflqqyyaiydsgdrqglldayhdgaccslsipfiarssla
eyfkdsrnvkklkdptlrfrllkhtrlnvvaflnelpktqhdvnsfvvdisaqtstllcf
svngvfkevdgksrdslraftrtfiavpasnsglcivndelfvrnasseeiqrafampap
tp

SCOPe Domain Coordinates for d1jn5b_:

Click to download the PDB-style file with coordinates for d1jn5b_.
(The format of our PDB-style files is described here.)

Timeline for d1jn5b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1jn5a_