Class c: Alpha and beta proteins (a/b) [51349] (121 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families) |
Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (13 proteins) family members also share a common alpha+beta fold in C-terminal domain |
Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (14 species) |
Species Spinach (Spinacia oleracea) [TaxId:3562] [69409] (2 PDB entries) |
Domain d1jn0b1: 1jn0 B:0-148,B:313-333 [66917] Other proteins in same PDB: d1jn0a2, d1jn0b2, d1jn0o2 complexed with ndp, so4 |
PDB Entry: 1jn0 (more details), 3 Å
SCOP Domain Sequences for d1jn0b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jn0b1 c.2.1.3 (B:0-148,B:313-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Spinach (Spinacia oleracea)} klkvaingfgrigrnflrcwhgkdspldvvvindtggvkqashllkydsilgtfdadvkt agdsaisvgkvikvvsdrnpvnlpwgdmgidlviegtgvfvdrdgagkhlqagakkvlit apgkgdiptyvvgvneegythadtiisnasXnewgysqrvvdladivankwq
Timeline for d1jn0b1:
View in 3D Domains from other chains: (mouse over for more information) d1jn0a1, d1jn0a2, d1jn0o1, d1jn0o2 |