Lineage for d1jmzb_ (1jmz B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2065823Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2065850Superfamily b.69.2: YVTN repeat-like/Quinoprotein amine dehydrogenase [50969] (4 families) (S)
  5. 2065871Family b.69.2.2: Quinohemoprotein amine dehydrogenase B chain [69309] (1 protein)
    less regular propeller with imperfect sequence repeats; quinone cofactor is a tryptophan derivative in another subunit
  6. 2065872Protein Quinohemoprotein amine dehydrogenase B chain [69310] (2 species)
  7. 2065876Species Pseudomonas putida [TaxId:303] [69312] (2 PDB entries)
  8. 2065878Domain d1jmzb_: 1jmz B: [66913]
    Other proteins in same PDB: d1jmza1, d1jmza2, d1jmza3, d1jmza4, d1jmza5, d1jmzg_
    complexed with hec, ni, pnd

Details for d1jmzb_

PDB Entry: 1jmz (more details), 2 Å

PDB Description: crystal structure of a quinohemoprotein amine dehydrogenase from pseudomonas putida with inhibitor
PDB Compounds: (B:) Amine Dehydrogenase

SCOPe Domain Sequences for d1jmzb_:

Sequence, based on SEQRES records: (download)

>d1jmzb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]}
gpalkagheymivtnypnnlhvvdvasdtvykscvmpdkfgpgtammapdnrtayvlnnh
ygdiygidldtckntfhanlssvpgevgrsmysfaispdgkevyatvnptqrlndhyvvk
pprlevfstadgleakpvrtfpmprqvylmraaddgslyvagpdiykmdvktgkytvalp
lrnwnrkgysapdvlyfwphqsprhefsmlytiarfkddkqdpatadllygylsvdlktg
kthtqefadltelyftglrspkdpnqiygvlnrlakydlkqrklikaanldhtyycvafd
kkgdklylggtfndlavfnpdtlekvkniklpggdmstttpqvfir

Sequence, based on observed residues (ATOM records): (download)

>d1jmzb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]}
gpalkagheymivtnypnnlhvvdvasdtvykscvmpdkfgpgtammapdnrtayvlnnh
ygdiygidldtckntfhanlssvpgevgrsmysfaispdgkevyatvnptqrlndhyvvk
pprlevfstadgleakpvrtfpmprqvylmraaddgslyvagpdiykmdvktgkytvalp
lrnwnrkgysapdvlyfwphqsprhefsmlytiarfatadllygylsvdlktgkthtqef
adltelyftglrspkdpnqiygvlnrlakydlkqrklikaanldhtyycvafdkkgdkly
lggtfndlavfnpdtlekvkniklpggdmstttpqvfir

SCOPe Domain Coordinates for d1jmzb_:

Click to download the PDB-style file with coordinates for d1jmzb_.
(The format of our PDB-style files is described here.)

Timeline for d1jmzb_: