Lineage for d1jmza5 (1jmz A:163-281)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2396657Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 2397295Superfamily b.61.4: Quinohemoprotein amine dehydrogenase A chain, domain 3 [69298] (1 family) (S)
  5. 2397296Family b.61.4.1: Quinohemoprotein amine dehydrogenase A chain, domain 3 [69299] (1 protein)
  6. 2397297Protein Quinohemoprotein amine dehydrogenase A chain, domain 3 [69300] (2 species)
  7. 2397301Species Pseudomonas putida [TaxId:303] [69302] (2 PDB entries)
  8. 2397303Domain d1jmza5: 1jmz A:163-281 [66912]
    Other proteins in same PDB: d1jmza1, d1jmza2, d1jmza3, d1jmza4, d1jmzb_, d1jmzg_
    complexed with hec, ni, pnd

Details for d1jmza5

PDB Entry: 1jmz (more details), 2 Å

PDB Description: crystal structure of a quinohemoprotein amine dehydrogenase from pseudomonas putida with inhibitor
PDB Compounds: (A:) Amine Dehydrogenase

SCOPe Domain Sequences for d1jmza5:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jmza5 b.61.4.1 (A:163-281) Quinohemoprotein amine dehydrogenase A chain, domain 3 {Pseudomonas putida [TaxId: 303]}
esaawaewqkarpkadalpgqwafsghmlakgdvrgvmsvtpdqgdtfkvevkgayadgt
pfngsgsailyngyewrgnvkvgdanlrqvfaaldgemkgrmfeaehdergldftavke

SCOPe Domain Coordinates for d1jmza5:

Click to download the PDB-style file with coordinates for d1jmza5.
(The format of our PDB-style files is described here.)

Timeline for d1jmza5: