Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (24 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.14: Quinohemoprotein amine dehydrogenase A chain, domains 4 and 5 [81294] (1 protein) |
Protein Quinohemoprotein amine dehydrogenase A chain, domains 4 and 5 [69176] (2 species) duplication: tandem repeat of two Ig-like domains |
Species Pseudomonas putida [TaxId:303] [69178] (2 PDB entries) |
Domain d1jmza4: 1jmz A:364-494 [66911] Other proteins in same PDB: d1jmza1, d1jmza2, d1jmza5, d1jmzb_, d1jmzg_ complexed with hec, ni, pnd |
PDB Entry: 1jmz (more details), 2 Å
SCOPe Domain Sequences for d1jmza4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jmza4 b.1.18.14 (A:364-494) Quinohemoprotein amine dehydrogenase A chain, domains 4 and 5 {Pseudomonas putida [TaxId: 303]} kveevkvvpafsiarigengasvpkvqgrfeaeawgkdangqplrigylpaswkvepfne ravededvkfagkmqadgvfvpggagpnperkmmtnnagnlkviatladggqtgeghmiv tvqrwnnpplp
Timeline for d1jmza4:
View in 3D Domains from same chain: (mouse over for more information) d1jmza1, d1jmza2, d1jmza3, d1jmza5 |