SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1jmza3 (1jmz A:282-363)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2032114Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2032858Family b.1.18.14: Quinohemoprotein amine dehydrogenase A chain, domains 4 and 5 [81294] (1 protein)
  6. 2032859Protein Quinohemoprotein amine dehydrogenase A chain, domains 4 and 5 [69176] (2 species)
    duplication: tandem repeat of two Ig-like domains
  7. 2032865Species Pseudomonas putida [TaxId:303] [69178] (2 PDB entries)
  8. 2032868Domain d1jmza3: 1jmz A:282-363 [66910]
    Other proteins in same PDB: d1jmza1, d1jmza2, d1jmza5, d1jmzb_, d1jmzg_
    complexed with hec, ni, pnd

Details for d1jmza3

PDB Entry: 1jmz (more details), 2 Å

PDB Description: crystal structure of a quinohemoprotein amine dehydrogenase from pseudomonas putida with inhibitor
PDB Compounds: (A:) Amine Dehydrogenase

SCOPe Domain Sequences for d1jmza3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jmza3 b.1.18.14 (A:282-363) Quinohemoprotein amine dehydrogenase A chain, domains 4 and 5 {Pseudomonas putida [TaxId: 303]}
gkarllavqpafikaggeseitlvgsglagkpdlgagvevtevleqtptlvrlkaraaad
akpgqrevavgtlkgvnlavyd

SCOPe Domain Coordinates for d1jmza3:

Click to download the PDB-style file with coordinates for d1jmza3.
(The format of our PDB-style files is described here.)

Timeline for d1jmza3: