Class b: All beta proteins [48724] (149 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (18 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.14: Quinohemoprotein amine dehydrogenase A chain, domains 4 and 5 [81294] (1 protein) |
Protein Quinohemoprotein amine dehydrogenase A chain, domains 4 and 5 [69176] (2 species) duplication: tandem repeat of two Ig-like domains |
Species Pseudomonas putida [TaxId:303] [69178] (2 PDB entries) |
Domain d1jmxa3: 1jmx A:282-363 [66903] Other proteins in same PDB: d1jmxa1, d1jmxa2, d1jmxa5, d1jmxb_, d1jmxg_ |
PDB Entry: 1jmx (more details), 1.9 Å
SCOP Domain Sequences for d1jmxa3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jmxa3 b.1.18.14 (A:282-363) Quinohemoprotein amine dehydrogenase A chain, domains 4 and 5 {Pseudomonas putida} gkarllavqpafikaggeseitlvgsglagkpdlgagvevtevleqtptlvrlkaraaad akpgqrevavgtlkgvnlavyd
Timeline for d1jmxa3:
View in 3D Domains from same chain: (mouse over for more information) d1jmxa1, d1jmxa2, d1jmxa4, d1jmxa5 |