Lineage for d1jmxa1 (1jmx A:2-85)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 94589Fold a.3: Cytochrome c [46625] (1 superfamily)
  4. 94590Superfamily a.3.1: Cytochrome c [46626] (7 families) (S)
  5. 94890Family a.3.1.7: Quinohemoprotein amine dehydrogenase A chain, domains 1 and 2 [68956] (1 protein)
  6. 94891Protein Quinohemoprotein amine dehydrogenase A chain, domains 1 and 2 [68957] (2 species)
  7. 94895Species Pseudomonas putida [TaxId:303] [68959] (2 PDB entries)
  8. 94896Domain d1jmxa1: 1jmx A:2-85 [66901]
    Other proteins in same PDB: d1jmxa3, d1jmxa4, d1jmxa5, d1jmxb_, d1jmxg_

Details for d1jmxa1

PDB Entry: 1jmx (more details), 1.9 Å

PDB Description: crystal structure of a quinohemoprotein amine dehydrogenase from pseudomonas putida

SCOP Domain Sequences for d1jmxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jmxa1 a.3.1.7 (A:2-85) Quinohemoprotein amine dehydrogenase A chain, domains 1 and 2 {Pseudomonas putida}
eqgpsllqnkcmgchipegndtysrishqrktpegwlmsiarmqvmhglqisdddrrtlv
kyladkqglapsetdgvryamerr

SCOP Domain Coordinates for d1jmxa1:

Click to download the PDB-style file with coordinates for d1jmxa1.
(The format of our PDB-style files is described here.)

Timeline for d1jmxa1: