Lineage for d1jmvd_ (1jmv D:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 392101Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 392401Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (5 families) (S)
    share similar mode of ligand (Adenosine group) binding
    can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group
  5. 392528Family c.26.2.4: Universal stress protein-like [52436] (3 proteins)
  6. 392537Protein Universal stress protein A, UspA [69461] (1 species)
  7. 392538Species Haemophilus influenzae [TaxId:727] [69462] (1 PDB entry)
    the nucleotide-binding is not known
  8. 392542Domain d1jmvd_: 1jmv D: [66900]
    structural genomics
    complexed with so4

Details for d1jmvd_

PDB Entry: 1jmv (more details), 1.85 Å

PDB Description: Structure of Haemophylus influenzae Universal Stress Protein At 1.85A Resolution

SCOP Domain Sequences for d1jmvd_:

Sequence, based on SEQRES records: (download)

>d1jmvd_ c.26.2.4 (D:) Universal stress protein A, UspA {Haemophilus influenzae}
mykhilvavdlseespillkkavgiakrhdaklsiihvdvnfsdlytglidvnmssmqdr
istetqkalldlaesvdypiseklsgsgdlgqvlsdaieqydvdllvtghhqdfwsklms
strqvmntikidmlvvp

Sequence, based on observed residues (ATOM records): (download)

>d1jmvd_ c.26.2.4 (D:) Universal stress protein A, UspA {Haemophilus influenzae}
mykhilvavdlseespillkkavgiakrhdaklsiihvdvnfslytglidvnmstqkall
dlaesvdypiseklsgsgdlgqvlsdaieqydvdllvtghhqdfwsklmsstrqvmntik
idmlvvp

SCOP Domain Coordinates for d1jmvd_:

Click to download the PDB-style file with coordinates for d1jmvd_.
(The format of our PDB-style files is described here.)

Timeline for d1jmvd_: